(data stored in ACNUC7421 zone)

EMBL: CP001720.PE432

CP001720.PE432       Location/Qualifiers
FT   CDS             482524..482871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yen:YE0510A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61397"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C8W545"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61397.1"
FT                   /translation="MLHYFTGLDFYLAEGGLKEAVEDLKRLDFSQRLQVLKAIDKVSSN
FT                   PFPQTEGGYGKPLGNRDSTKLAGYLKIKLKKLGLRVVYKLVMENDVMRVIIISARADDE
FT                   VYLMAQKRTDK"
     MLHYFTGLDF YLAEGGLKEA VEDLKRLDFS QRLQVLKAID KVSSNPFPQT EGGYGKPLGN        60
     RDSTKLAGYL KIKLKKLGLR VVYKLVMEND VMRVIIISAR ADDEVYLMAQ KRTDK            115
//

If you have problems or comments...

PBIL Back to PBIL home page