(data stored in ACNUC7421 zone)

EMBL: CP001720.PE433

CP001720.PE433       Location/Qualifiers
FT   CDS             483304..483756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61398"
FT                   /db_xref="GOA:C8W546"
FT                   /db_xref="UniProtKB/TrEMBL:C8W546"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61398.1"
FT                   /translation="MNNRLYNIIFPIWLMLFNPLIGIPMLFVNYFIDRSIYYLILRNNE
FT                   FYVNNKKSFNTCVNLAFIMGITVDFLGFIFLVLVKGLEYSNYKEWIGLEVIFTIIGCSL
FT                   LIGFLNYHLSLTLKIPKNIAFKIGVCMGIITTPWLFLIPPYYNNFK"
     MNNRLYNIIF PIWLMLFNPL IGIPMLFVNY FIDRSIYYLI LRNNEFYVNN KKSFNTCVNL        60
     AFIMGITVDF LGFIFLVLVK GLEYSNYKEW IGLEVIFTII GCSLLIGFLN YHLSLTLKIP       120
     KNIAFKIGVC MGIITTPWLF LIPPYYNNFK                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page