(data stored in ACNUC7421 zone)

EMBL: CP001720.PE434

CP001720.PE434       Location/Qualifiers
FT   CDS             485017..485694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0471"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="KEGG: bsu:BSU07580 two-component sensor histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61399"
FT                   /db_xref="GOA:C8W547"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C8W547"
FT                   /inference="protein motif:COG:COG3290"
FT                   /protein_id="ACV61399.1"
FT                   /translation="MIVIISFFETSKERRKALGGNESGFTVTIRKIEEYAEKDCEAKRN
FT                   AENLKQINQLINSSRKHRHDFHHQLQAIYGLLESGSYEGAKNYINSFFGTITKTRELIE
FT                   TDNVNVSAILNTKVGLAEARNIDLEVGVECNLKELPLSSFDVSSLLGNLIDNALEAVEN
FT                   NESEHRQVKVMIDFERGQTNWAGYPGIYFQTRFYIKRRPLQPGSVHSKGHHSQIRRWCR
FT                   SEQ"
     MIVIISFFET SKERRKALGG NESGFTVTIR KIEEYAEKDC EAKRNAENLK QINQLINSSR        60
     KHRHDFHHQL QAIYGLLESG SYEGAKNYIN SFFGTITKTR ELIETDNVNV SAILNTKVGL       120
     AEARNIDLEV GVECNLKELP LSSFDVSSLL GNLIDNALEA VENNESEHRQ VKVMIDFERG       180
     QTNWAGYPGI YFQTRFYIKR RPLQPGSVHS KGHHSQIRRW CRSEQ                       225
//

If you have problems or comments...

PBIL Back to PBIL home page