(data stored in ACNUC7421 zone)

EMBL: CP001720.PE436

CP001720.PE436       Location/Qualifiers
FT   CDS             486210..487163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0473"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ppd:Ppro_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61401"
FT                   /db_xref="GOA:C8W549"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C8W549"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACV61401.1"
FT                   /translation="MQKKEVGPERRFITSPYMLLTLATLFWAGNTVVGKAANLLIPAFS
FT                   LSFWRWVVALFLILPFGVRAVQRDWDFYCKNWKYLMMLAFFSVTAFNTFLYWALNWTTA
FT                   INVSVIFATMPLVIFFLSWMVGGQKAKVNQIIGVLLALIGVLIVISKGNISILMNLNIN
FT                   YGDILVLVSVVCFGIYSILFKKLQADVDQIGLITVFIFFGLIGIAPFYAWDIYQHHFFS
FT                   VDIKMVWILLYVGLFPSLLSFFFWNKAIESGGAHIAGMFFNLVPVFSSVLAVIFLKEIF
FT                   TLSHLIGMVLIFIGIYFSTFYEHRPLEADIQRENRA"
     MQKKEVGPER RFITSPYMLL TLATLFWAGN TVVGKAANLL IPAFSLSFWR WVVALFLILP        60
     FGVRAVQRDW DFYCKNWKYL MMLAFFSVTA FNTFLYWALN WTTAINVSVI FATMPLVIFF       120
     LSWMVGGQKA KVNQIIGVLL ALIGVLIVIS KGNISILMNL NINYGDILVL VSVVCFGIYS       180
     ILFKKLQADV DQIGLITVFI FFGLIGIAPF YAWDIYQHHF FSVDIKMVWI LLYVGLFPSL       240
     LSFFFWNKAI ESGGAHIAGM FFNLVPVFSS VLAVIFLKEI FTLSHLIGMV LIFIGIYFST       300
     FYEHRPLEAD IQRENRA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page