(data stored in ACNUC7421 zone)

EMBL: CP001720.PE438

CP001720.PE438       Location/Qualifiers
FT   CDS             488039..488851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0475"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: pca:Pcar_0192
FT                   molybdopterin oxidoreductase/precorrin-4 methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61403"
FT                   /db_xref="GOA:C8W551"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C8W551"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACV61403.1"
FT                   /translation="MKNKVIGRGKFYVIGKGPAGPQMATLQALNMIEQMDAIVAPDNDV
FT                   KLFAEYVGEKPVLFDPWEGFWNYEGKQMLDLTEDEMEKFRIKRFNLRDERVNTIKEFLI
FT                   QGKDVALLDAGNPCFFGPSHWYVEQFDQQDIVIIPGMGCEAAALAALGKSIIPSYDTRF
FT                   VMQTAPLYLEGWEQILKDLNQYPVSIVAYMTLSNPKKLFAGLEKLYPTDMPCAIVYWAG
FT                   YPDKQRVIRGTVADMGQKLSEDEENHMGLLFIGRFLNGKPYEAAMKQQ"
     MKNKVIGRGK FYVIGKGPAG PQMATLQALN MIEQMDAIVA PDNDVKLFAE YVGEKPVLFD        60
     PWEGFWNYEG KQMLDLTEDE MEKFRIKRFN LRDERVNTIK EFLIQGKDVA LLDAGNPCFF       120
     GPSHWYVEQF DQQDIVIIPG MGCEAAALAA LGKSIIPSYD TRFVMQTAPL YLEGWEQILK       180
     DLNQYPVSIV AYMTLSNPKK LFAGLEKLYP TDMPCAIVYW AGYPDKQRVI RGTVADMGQK       240
     LSEDEENHMG LLFIGRFLNG KPYEAAMKQQ                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page