(data stored in ACNUC7421 zone)

EMBL: CP001720.PE447

CP001720.PE447       Location/Qualifiers
FT   CDS             497452..498210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0486"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pca:Pcar_3057 ATP-binding component of
FT                   citrate-dependent iron (III) transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61412"
FT                   /db_xref="GOA:C8W5V7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5V7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61412.1"
FT                   /translation="MINVQHLTFSYCKAFQVLKNIEFTANVGQCVAILGNNGAGKSTMV
FT                   KCLNRILEPQEGAVVVNGRDVSKLKRQTIAQDMAYVSQQNDSSKFTVYDSVLLGRKPYI
FT                   KMNPTDEDHRITKDIIDRMGLNSFTLRYIDELSGGELQKVMLARALAQQPKVLMLDEPT
FT                   SNLDLKNQYEVMGIVHDIAIEDKLCVIIVIHDLNLAIRYCDRFLFIKNNHVYSLGGAET
FT                   VNCEAIRDVYGMDVTIENIRGYRTVVPLCG"
     MINVQHLTFS YCKAFQVLKN IEFTANVGQC VAILGNNGAG KSTMVKCLNR ILEPQEGAVV        60
     VNGRDVSKLK RQTIAQDMAY VSQQNDSSKF TVYDSVLLGR KPYIKMNPTD EDHRITKDII       120
     DRMGLNSFTL RYIDELSGGE LQKVMLARAL AQQPKVLMLD EPTSNLDLKN QYEVMGIVHD       180
     IAIEDKLCVI IVIHDLNLAI RYCDRFLFIK NNHVYSLGGA ETVNCEAIRD VYGMDVTIEN       240
     IRGYRTVVPL CG                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page