(data stored in ACNUC7421 zone)

EMBL: CP001720.PE450

CP001720.PE450       Location/Qualifiers
FT   CDS             500421..501581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0489"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: bar:GBAA5105 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61415"
FT                   /db_xref="GOA:C8W5W0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV61415.1"
FT                   /translation="MKSERDKRRNDYTKLKRKVFFRMLLIIFTTAATVIFLRFVIQKNF
FT                   SVGDSIVQFLKNTFHMRDRDALIMYRFAFFNNIEAITLIVILIFLVILLKFSLSWFTKY
FT                   FDEVSAGMDKLTEESDAGITLSPELDFMENKLNQIKNNLEKQKKAALDAEQRKNDLVVY
FT                   LAHDIKTPLTSVIGYLSLLDEAPDMPPEQKAKYVGITLEKAYRLEQLINEFFEITRFNL
FT                   QTIVLNREKINLLFMLQQMADEFYPILTPQEKRVSVNVPDGLILWGDADKLARVFNNIL
FT                   KNAIAYSYENSVIDISAKQQEKNIVITFNNQGNPIPREKLETIFEKFFRLDTSRSTNTG
FT                   GAGLGLAIAKEIVNAHGGNIFVQSNTEKTVFTVVFPQKQEKDKLSA"
     MKSERDKRRN DYTKLKRKVF FRMLLIIFTT AATVIFLRFV IQKNFSVGDS IVQFLKNTFH        60
     MRDRDALIMY RFAFFNNIEA ITLIVILIFL VILLKFSLSW FTKYFDEVSA GMDKLTEESD       120
     AGITLSPELD FMENKLNQIK NNLEKQKKAA LDAEQRKNDL VVYLAHDIKT PLTSVIGYLS       180
     LLDEAPDMPP EQKAKYVGIT LEKAYRLEQL INEFFEITRF NLQTIVLNRE KINLLFMLQQ       240
     MADEFYPILT PQEKRVSVNV PDGLILWGDA DKLARVFNNI LKNAIAYSYE NSVIDISAKQ       300
     QEKNIVITFN NQGNPIPREK LETIFEKFFR LDTSRSTNTG GAGLGLAIAK EIVNAHGGNI       360
     FVQSNTEKTV FTVVFPQKQE KDKLSA                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page