(data stored in ACNUC7421 zone)

EMBL: CP001720.PE451

CP001720.PE451       Location/Qualifiers
FT   CDS             complement(501626..502354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0490"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: bar:GBAA0962
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61416"
FT                   /db_xref="GOA:C8W5W1"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W1"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ACV61416.1"
FT                   /translation="MIFMILMFIIVSITWFISTLPFLIPYHILLTSQSKKIGYKLSIEH
FT                   IAIVYIFVYYLTGVLSFTGIPSIRDIVHNSFGIITPKGLNFPQDEINLIPFYWITEGVR
FT                   PYIENILLFIPLGFILPCIWGKYEVLWKTALSGITFSLIIELSQLFNRRVTDIDDLLMN
FT                   TLGTLIGWVIFRLLIEHLSKLQDKVSVQSTNIEKIPLLLREEACFYMVSAFAGMFFVFY
FT                   PFLRSLLIPFLRSLFGFVLI"
     MIFMILMFII VSITWFISTL PFLIPYHILL TSQSKKIGYK LSIEHIAIVY IFVYYLTGVL        60
     SFTGIPSIRD IVHNSFGIIT PKGLNFPQDE INLIPFYWIT EGVRPYIENI LLFIPLGFIL       120
     PCIWGKYEVL WKTALSGITF SLIIELSQLF NRRVTDIDDL LMNTLGTLIG WVIFRLLIEH       180
     LSKLQDKVSV QSTNIEKIPL LLREEACFYM VSAFAGMFFV FYPFLRSLLI PFLRSLFGFV       240
     LI                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page