(data stored in ACNUC7421 zone)

EMBL: CP001720.PE452

CP001720.PE452       Location/Qualifiers
FT   CDS             502634..503755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0491"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; KEGG: wsu:WS0721 penicillin-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61417"
FT                   /db_xref="GOA:C8W5W2"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W2"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ACV61417.1"
FT                   /translation="MVRKVKNKKPGIRIFITFLLMVGIAAFVYQSIIIPGYRHIFEKEY
FT                   DDKTTLYSSLKATLVSYGNKTMPAPSLKLEAEPSVSISPGELNSPNAILINLKDHTILM
FT                   QKNSEEKIYPASLTKMMTAIVAIENLPDLKKEITLTDSVFRGLSEADASMAGFRPGENV
FT                   RAIDLLYGALLPSGAESCVELADYIAGSEKDFVGMMNQKAADLGMYNTYFENSTGLQNE
FT                   NHYTTVKDLAVLLSYALQNDTFREIFTSTRHSTPPTNKHPDGITFYSTMFDELNNRSIT
FT                   DGKILGGKTGYTAEAGLCLASLAQVGKQEYSLISAGAKGDHHSEQYNITDALAVYNRLG
FT                   KNDYKVNSARVTEDVLRQHDKRRLNNPPLKRPQ"
     MVRKVKNKKP GIRIFITFLL MVGIAAFVYQ SIIIPGYRHI FEKEYDDKTT LYSSLKATLV        60
     SYGNKTMPAP SLKLEAEPSV SISPGELNSP NAILINLKDH TILMQKNSEE KIYPASLTKM       120
     MTAIVAIENL PDLKKEITLT DSVFRGLSEA DASMAGFRPG ENVRAIDLLY GALLPSGAES       180
     CVELADYIAG SEKDFVGMMN QKAADLGMYN TYFENSTGLQ NENHYTTVKD LAVLLSYALQ       240
     NDTFREIFTS TRHSTPPTNK HPDGITFYST MFDELNNRSI TDGKILGGKT GYTAEAGLCL       300
     ASLAQVGKQE YSLISAGAKG DHHSEQYNIT DALAVYNRLG KNDYKVNSAR VTEDVLRQHD       360
     KRRLNNPPLK RPQ                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page