(data stored in ACNUC7421 zone)

EMBL: CP001720.PE454

CP001720.PE454       Location/Qualifiers
FT   CDS             504880..505767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0493"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sml:Smlt3250 putative sugar
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61419"
FT                   /db_xref="GOA:C8W5W4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61419.1"
FT                   /translation="MLNRNHRIKKILHITVLRVLAALFIFPLAVTVTNSFMSEQEIANN
FT                   YDPVADKNLSSYNDDTANHFARFQLIPDVVVLKQYYNVLIKKTQFLFMFWNSVLITFPI
FT                   VIGQTIVATLAAYAFAKLKFRGRNFLFVFYIIVMLMPFQVTLVPNYLMAGQLGLLNSRW
FT                   SIILPGIFSTFGVFLLKQYMEQIPDSYIEAARVDGANQLQIFLKIILPMSKAGIAAMAI
FT                   LVFIDNWNMVEQPLIFLQDAAKQPLSLYLSRIIDGEKGLAFAASTLYMMPALLNFLYAE
FT                   KYLLEGIRLSGIKG"
     MLNRNHRIKK ILHITVLRVL AALFIFPLAV TVTNSFMSEQ EIANNYDPVA DKNLSSYNDD        60
     TANHFARFQL IPDVVVLKQY YNVLIKKTQF LFMFWNSVLI TFPIVIGQTI VATLAAYAFA       120
     KLKFRGRNFL FVFYIIVMLM PFQVTLVPNY LMAGQLGLLN SRWSIILPGI FSTFGVFLLK       180
     QYMEQIPDSY IEAARVDGAN QLQIFLKIIL PMSKAGIAAM AILVFIDNWN MVEQPLIFLQ       240
     DAAKQPLSLY LSRIIDGEKG LAFAASTLYM MPALLNFLYA EKYLLEGIRL SGIKG            295
//

If you have problems or comments...

PBIL Back to PBIL home page