(data stored in ACNUC7421 zone)

EMBL: CP001720.PE458

CP001720.PE458       Location/Qualifiers
FT   CDS             complement(511714..512337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61423"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61423.1"
FT                   /translation="MTKKIFIMLALVILLTVITGCQNRHSEKEEAVTGDKFVLPPFTKI
FT                   TLYVDGKKMDLKKNDPKVKKLSGEIYKGVINITDAVGGNRTFRPVGFEGDPKVVTKEYL
FT                   KDTVLIFAEWDKRHNISSKQKEMTLGHQGWEGTPKDKDGNYIINTDGFLVEIYKPNLDS
FT                   HFGYKKWSDGIGVSLKKPEEPVYWAYVEYDSLNCEKLLNIIVND"
     MTKKIFIMLA LVILLTVITG CQNRHSEKEE AVTGDKFVLP PFTKITLYVD GKKMDLKKND        60
     PKVKKLSGEI YKGVINITDA VGGNRTFRPV GFEGDPKVVT KEYLKDTVLI FAEWDKRHNI       120
     SSKQKEMTLG HQGWEGTPKD KDGNYIINTD GFLVEIYKPN LDSHFGYKKW SDGIGVSLKK       180
     PEEPVYWAYV EYDSLNCEKL LNIIVND                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page