(data stored in ACNUC7421 zone)

EMBL: CP001720.PE459

CP001720.PE459       Location/Qualifiers
FT   CDS             complement(512405..514066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61424.1"
FT                   /translation="MKKILTLFLVIVFGVYSSTGVALAATDDDGKKEFSVLSVGDYDSY
FT                   ANLTFEDANYFDDYLQDTLGWTKIQYEVDPNPNGTGDNYNPTDKTAIGVSLGDFTDQGS
FT                   GTVPQADQGDLLYFMGHAYPSEMLLKDELDSVSYTDVGSTYDSGTKSSNSAWDDDLEWI
FT                   ILGACSIANRDSSGVQWAKTLLGSPRRAHGIYGYKGSSPSNPQDLYVAQRFFQNAAGSS
FT                   PQTIWSSWINANNATQATNWGVIEHKNNRDYLWGKGTVTSDTTGDPVIYQYQYNHSPIE
FT                   IFNATKSNSVTNDVYGLNTSFNVSPEELDEDTIINQFFDGKDKLAKNKDNNGNLLVEGP
FT                   SGSNLEIYNTSGAVLYSKEITEETINFGTDNAISKAEEFIKVHGGRPFDATISKIWPLE
FT                   KTVIDIFNDTTGTPETIGYLVEYKRVINGMLVDGYNGDSIRVLIDKNGVSNYYRLWRDI
FT                   KSNDGNKKVNNAEAKGNDNNIKNIIASGQALEKAKRNANKIYKINKDINPTDAELVYFS
FT                   KSFMHDQQIMEPAWRVKIDVNAYLYVNAYTGEVEEY"
     MKKILTLFLV IVFGVYSSTG VALAATDDDG KKEFSVLSVG DYDSYANLTF EDANYFDDYL        60
     QDTLGWTKIQ YEVDPNPNGT GDNYNPTDKT AIGVSLGDFT DQGSGTVPQA DQGDLLYFMG       120
     HAYPSEMLLK DELDSVSYTD VGSTYDSGTK SSNSAWDDDL EWIILGACSI ANRDSSGVQW       180
     AKTLLGSPRR AHGIYGYKGS SPSNPQDLYV AQRFFQNAAG SSPQTIWSSW INANNATQAT       240
     NWGVIEHKNN RDYLWGKGTV TSDTTGDPVI YQYQYNHSPI EIFNATKSNS VTNDVYGLNT       300
     SFNVSPEELD EDTIINQFFD GKDKLAKNKD NNGNLLVEGP SGSNLEIYNT SGAVLYSKEI       360
     TEETINFGTD NAISKAEEFI KVHGGRPFDA TISKIWPLEK TVIDIFNDTT GTPETIGYLV       420
     EYKRVINGML VDGYNGDSIR VLIDKNGVSN YYRLWRDIKS NDGNKKVNNA EAKGNDNNIK       480
     NIIASGQALE KAKRNANKIY KINKDINPTD AELVYFSKSF MHDQQIMEPA WRVKIDVNAY       540
     LYVNAYTGEV EEY                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page