(data stored in ACNUC7421 zone)

EMBL: CP001720.PE463

CP001720.PE463       Location/Qualifiers
FT   CDS             complement(516556..516831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61428"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61428.1"
FT                   /translation="MLKFSPPPEKFGVSDNQQEFDVDGFTHLLGVLLKRSIDAHDRLTI
FT                   HTVWRTYGTFSEELVRITLGQLLGGGHPTSDLSGYLDALRIAALSQ"
     MLKFSPPPEK FGVSDNQQEF DVDGFTHLLG VLLKRSIDAH DRLTIHTVWR TYGTFSEELV        60
     RITLGQLLGG GHPTSDLSGY LDALRIAALS Q                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page