(data stored in ACNUC7421 zone)

EMBL: CP001720.PE465

CP001720.PE465       Location/Qualifiers
FT   CDS             complement(517515..518291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0507"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   maq:Maqu_3709 IstB ATP binding domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61430"
FT                   /db_xref="GOA:C8W5X5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X5"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACV61430.1"
FT                   /translation="MTNQSTIDKLIEMRLTAMSNSFRNQLTDAKMKDVPFEDRFGMLVD
FT                   IEYSNRKNNRLKRLIRNADFDQPGASVMDIDYTSGRKLNKQLIVRLGTCEYITEYRNIF
FT                   ITGATGSGKTYMACAFGMEACKQHYTTRYVRLPDLLIDLEIARNEGTYKKVMAKYANPL
FT                   LLIIDEWLLLKPNENERKDIFELLHRRRKKSSTIFCSQYRLDGWYEQLGGSDGPLADAI
FT                   LDRIVHDAYKINIESIDPAKDVSMREVYGLDKMLSE"
     MTNQSTIDKL IEMRLTAMSN SFRNQLTDAK MKDVPFEDRF GMLVDIEYSN RKNNRLKRLI        60
     RNADFDQPGA SVMDIDYTSG RKLNKQLIVR LGTCEYITEY RNIFITGATG SGKTYMACAF       120
     GMEACKQHYT TRYVRLPDLL IDLEIARNEG TYKKVMAKYA NPLLLIIDEW LLLKPNENER       180
     KDIFELLHRR RKKSSTIFCS QYRLDGWYEQ LGGSDGPLAD AILDRIVHDA YKINIESIDP       240
     AKDVSMREVY GLDKMLSE                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page