(data stored in ACNUC7421 zone)

EMBL: CP001720.PE466

CP001720.PE466       Location/Qualifiers
FT   CDS             complement(520864..521262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61431"
FT                   /db_xref="GOA:C8W5X6"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61431.1"
FT                   /translation="MLDASFFKLISVFFYILILKVGIKKQISFYRHIVIIFFYTYIIGM
FT                   ISITLFPIPIQKEVIAEYAELELLKNNFIPFQDINSMIKSNSTSVIYRQIIGNMVLFMP
FT                   MGFLIPLVFNKMSTFYKVIFVSFFHLLQ"
     MLDASFFKLI SVFFYILILK VGIKKQISFY RHIVIIFFYT YIIGMISITL FPIPIQKEVI        60
     AEYAELELLK NNFIPFQDIN SMIKSNSTSV IYRQIIGNMV LFMPMGFLIP LVFNKMSTFY       120
     KVIFVSFFHL LQ                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page