(data stored in ACNUC7421 zone)

EMBL: CP001720.PE468

CP001720.PE468       Location/Qualifiers
FT   CDS             complement(523543..523866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61433"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61433.1"
FT                   /translation="MLRAIFLLVILSLIIMLIGCSNDVYIPPDPIVDVKTYGDITKTKQ
FT                   KKLKIIVKNVTDSDLINVELWVGRNNISTKNKDLSKKVKNIKPGGIIKYYANITAQLPH
FT                   YKI"
     MLRAIFLLVI LSLIIMLIGC SNDVYIPPDP IVDVKTYGDI TKTKQKKLKI IVKNVTDSDL        60
     INVELWVGRN NISTKNKDLS KKVKNIKPGG IIKYYANITA QLPHYKI                     107
//

If you have problems or comments...

PBIL Back to PBIL home page