(data stored in ACNUC7421 zone)

EMBL: CP001720.PE470

CP001720.PE470       Location/Qualifiers
FT   CDS             525055..526251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0515"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bar:GBAA2786 glycine betaine/L-proline ABC
FT                   transporter, ATP-binding protein; TIGRFAM: glycine
FT                   betaine/L-proline ABC transporter, ATPase subunit; PFAM:
FT                   ABC transporter related; CBS domain-containing protein;
FT                   SMART: AAA ATPase; CBS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61435"
FT                   /db_xref="GOA:C8W5Y0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y0"
FT                   /inference="protein motif:TFAM:TIGR01186"
FT                   /protein_id="ACV61435.1"
FT                   /translation="MSKIIVQDIIKIFGDHPEQALKLLKQNVSKKEILKKTKQTIGVYN
FT                   VNFEVGTGEIFVLMGLSGSGKSTLLRLLNRLIEPTRGKVYIDGENVTAVDDEKLREIRR
FT                   KKIGMVFQRFALFPHRTILENVAYGLEIQGMGKEERAKKARETLKLVGLSGWEDSYPGQ
FT                   LSGGMQQRVGLARALASDPDILLMDEAFSALDPLIRKEMQDELLSLQEQMNKTIIFVTH
FT                   DLDEALKIGDRIALMNDGTIVQIGTPEEILTNPANEYVEKFVEDVDMTKVLTAEGVMKR
FT                   PDVIVRLKDGPRSALRLMRENGISSIFVVGKDRKLVGLVVADDALKATQEKRDFSNIII
FT                   EDVPTVAPDTPINDLMSLVAESKYPIAVINEDRRLLGIIVRGAVLAGLVRRGGDDNVA"
     MSKIIVQDII KIFGDHPEQA LKLLKQNVSK KEILKKTKQT IGVYNVNFEV GTGEIFVLMG        60
     LSGSGKSTLL RLLNRLIEPT RGKVYIDGEN VTAVDDEKLR EIRRKKIGMV FQRFALFPHR       120
     TILENVAYGL EIQGMGKEER AKKARETLKL VGLSGWEDSY PGQLSGGMQQ RVGLARALAS       180
     DPDILLMDEA FSALDPLIRK EMQDELLSLQ EQMNKTIIFV THDLDEALKI GDRIALMNDG       240
     TIVQIGTPEE ILTNPANEYV EKFVEDVDMT KVLTAEGVMK RPDVIVRLKD GPRSALRLMR       300
     ENGISSIFVV GKDRKLVGLV VADDALKATQ EKRDFSNIII EDVPTVAPDT PINDLMSLVA       360
     ESKYPIAVIN EDRRLLGIIV RGAVLAGLVR RGGDDNVA                               398
//

If you have problems or comments...

PBIL Back to PBIL home page