(data stored in ACNUC7421 zone)

EMBL: CP001720.PE472

CP001720.PE472       Location/Qualifiers
FT   CDS             527090..527989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0517"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bsu:BSU03000 glycine
FT                   betaine ABC transporter (glycine betaine-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61437"
FT                   /db_xref="GOA:C8W5Y2"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y2"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ACV61437.1"
FT                   /translation="MRKIFKLLGIVGMLIALSTLLFGCGSSDSKDGQRNVSVKEKFNGE
FT                   IIGIEPGAGLMKKTEQAIKDYGLDFTLRDSSSAGMSATLANKIKNKEWVIVTGWTPHWK
FT                   WAAYDLKYLEDPKKVFGEEEHISTIARKGLAEDKPEAYKILDNFHWTPDDMQTVMLDVH
FT                   EGMSPDDAAKKWIAAHRDKVVEWTKDVDKSAAAGKTVKLGYVEWDSEIASTHVVKNVMQ
FT                   DLGFKAEATPVDNAIMWQGVSQGSFDAMVSAWLPGTHGDLYDKVKDTIDNLGPNLEGAK
FT                   IGLVVPDYVTINSIEELK"
     MRKIFKLLGI VGMLIALSTL LFGCGSSDSK DGQRNVSVKE KFNGEIIGIE PGAGLMKKTE        60
     QAIKDYGLDF TLRDSSSAGM SATLANKIKN KEWVIVTGWT PHWKWAAYDL KYLEDPKKVF       120
     GEEEHISTIA RKGLAEDKPE AYKILDNFHW TPDDMQTVML DVHEGMSPDD AAKKWIAAHR       180
     DKVVEWTKDV DKSAAAGKTV KLGYVEWDSE IASTHVVKNV MQDLGFKAEA TPVDNAIMWQ       240
     GVSQGSFDAM VSAWLPGTHG DLYDKVKDTI DNLGPNLEGA KIGLVVPDYV TINSIEELK        299
//

If you have problems or comments...

PBIL Back to PBIL home page