(data stored in ACNUC7421 zone)

EMBL: CP001720.PE473

CP001720.PE473       Location/Qualifiers
FT   CDS             528133..529506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0518"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: cation transporter; KEGG: bsu:BSU13500
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61438"
FT                   /db_xref="GOA:C8W5Y3"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y3"
FT                   /inference="protein motif:PRIAM:3.6.3.14"
FT                   /protein_id="ACV61438.1"
FT                   /translation="MAYLKSTRLNFNKRFSLTPVQLMVLGYFLFTIIGAMLLISPFSLN
FT                   TGKQLNLIDAFFTATSAVSVTGLTVVSTPDTFSLTGRIILSFLLQFGGIGIMVLGTLVY
FT                   ILSGTKIHLRTYAMIRIEQNQTSIHGMVSLMLFILKVAVIFEILGAIILTSRFFINYHM
FT                   PFSDALGMGIFYSISGFTNAGFDLFGHGLQNFQQDYLIQSVISILLLSGAIGFPVLLEA
FT                   HSYYLSLRKKTRFTFSLYTKVTTMTFLILLFLGFIFVLLSELHGPLANMSWQEKVSVAF
FT                   FHSLNTRSGGFSTIDINVFSTPTLLFLSLLMFIGASPSSCGGGIRTTTFAINLISVFSY
FT                   MRGRNSVKIMNRELYPEDILRSFMVSFFAAMLVILSVIFLMETENFASREILFEVCSAF
FT                   GTTGLSTGIATNLSVTGKLIIIFLMFVGRVGILSLLMLLHNHRLRDKYHIIKERIIVG"
     MAYLKSTRLN FNKRFSLTPV QLMVLGYFLF TIIGAMLLIS PFSLNTGKQL NLIDAFFTAT        60
     SAVSVTGLTV VSTPDTFSLT GRIILSFLLQ FGGIGIMVLG TLVYILSGTK IHLRTYAMIR       120
     IEQNQTSIHG MVSLMLFILK VAVIFEILGA IILTSRFFIN YHMPFSDALG MGIFYSISGF       180
     TNAGFDLFGH GLQNFQQDYL IQSVISILLL SGAIGFPVLL EAHSYYLSLR KKTRFTFSLY       240
     TKVTTMTFLI LLFLGFIFVL LSELHGPLAN MSWQEKVSVA FFHSLNTRSG GFSTIDINVF       300
     STPTLLFLSL LMFIGASPSS CGGGIRTTTF AINLISVFSY MRGRNSVKIM NRELYPEDIL       360
     RSFMVSFFAA MLVILSVIFL METENFASRE ILFEVCSAFG TTGLSTGIAT NLSVTGKLII       420
     IFLMFVGRVG ILSLLMLLHN HRLRDKYHII KERIIVG                                457
//

If you have problems or comments...

PBIL Back to PBIL home page