(data stored in ACNUC7421 zone)

EMBL: CP001720.PE474

CP001720.PE474       Location/Qualifiers
FT   CDS             529603..530280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0519"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: bha:BH2663 potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61439"
FT                   /db_xref="GOA:C8W5Y4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y4"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACV61439.1"
FT                   /translation="MFKVKKKSIIVIGIGRFGRGVIEGLFERGHDILAIDRDEAALDDV
FT                   RDMIVSGTILDVEDDEELSRIIGKNNFEEAVVAMGNDFEGTLIATHVLKEAGISVSVKA
FT                   ASERRGIVLKKMGADRVVFPERDMGRRLAHLISNDAIIDLLELPQGFVVEQMEVGVRFT
FT                   ERTFVEMNIPKRFAVYVLLIYRDNQSILPQANTRLKKGDEIIIFGQRDKLELFELENLR
FT                   DDK"
     MFKVKKKSII VIGIGRFGRG VIEGLFERGH DILAIDRDEA ALDDVRDMIV SGTILDVEDD        60
     EELSRIIGKN NFEEAVVAMG NDFEGTLIAT HVLKEAGISV SVKAASERRG IVLKKMGADR       120
     VVFPERDMGR RLAHLISNDA IIDLLELPQG FVVEQMEVGV RFTERTFVEM NIPKRFAVYV       180
     LLIYRDNQSI LPQANTRLKK GDEIIIFGQR DKLELFELEN LRDDK                       225
//

If you have problems or comments...

PBIL Back to PBIL home page