(data stored in ACNUC7421 zone)

EMBL: CP001720.PE476

CP001720.PE476       Location/Qualifiers
FT   CDS             531195..532379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0521"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   tdn:Suden_0535 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61441"
FT                   /db_xref="GOA:C8W5Y6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y6"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACV61441.1"
FT                   /translation="MKKKLFIVLTILLILSGAITTVLHKEKQVAALSKPETAPYVFNGV
FT                   KAYKGSMTNYLSFQGEFQSDNEAQVKTKLTGNILSILEEGTTFKKGDVLVKLDDREIAD
FT                   GINVLEFNKAALINEMEGLQTIVSAQKIQMENALKNYERNKTLFQSGALSGQALDNAQN
FT                   LYQQAQSSYQDINTKLNVYQQKINSLNSQISQQKNLLSYTTILAPFDGVVAKKLLNTGE
FT                   LAGSTSPILQISGLGGYKVMVKVPVQVAAQINLQDDTLLTYGEQVVRAQIDKVLPAGEN
FT                   NLSVIELRLPNNTFQVPVHTFLQVQIPTGAQQNGIIIPVEAKFKNADNNTFAVKEVNGL
FT                   AVIIPVKVLVENNQNACVEGNIQSGDTLVIGYESKLLNLPANTRIKVVLKNDNK"
     MKKKLFIVLT ILLILSGAIT TVLHKEKQVA ALSKPETAPY VFNGVKAYKG SMTNYLSFQG        60
     EFQSDNEAQV KTKLTGNILS ILEEGTTFKK GDVLVKLDDR EIADGINVLE FNKAALINEM       120
     EGLQTIVSAQ KIQMENALKN YERNKTLFQS GALSGQALDN AQNLYQQAQS SYQDINTKLN       180
     VYQQKINSLN SQISQQKNLL SYTTILAPFD GVVAKKLLNT GELAGSTSPI LQISGLGGYK       240
     VMVKVPVQVA AQINLQDDTL LTYGEQVVRA QIDKVLPAGE NNLSVIELRL PNNTFQVPVH       300
     TFLQVQIPTG AQQNGIIIPV EAKFKNADNN TFAVKEVNGL AVIIPVKVLV ENNQNACVEG       360
     NIQSGDTLVI GYESKLLNLP ANTRIKVVLK NDNK                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page