(data stored in ACNUC7421 zone)

EMBL: CP001720.PE477

CP001720.PE477       Location/Qualifiers
FT   CDS             532366..535464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0522"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   nis:NIS_0076 RND efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61442"
FT                   /db_xref="GOA:C8W5Y7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y7"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACV61442.1"
FT                   /translation="MIISKIMNRPHFIYTILIILFVMGVVGYFMLPQNMFPDAERPQIS
FT                   IVTLEPGASSSYIADHVSRPIEKVLYSVSQVRKVSSTSRDEVSVVTAEFEYSKGLEGAA
FT                   TDTANALSRATNSLPQDIKQPQIYKIGAYTPPVMIWALSPQKGSNLALADVRYLAANSI
FT                   ADQLVKVRAIANVDIFGGYEKEVVVEINKDKLSSYDLNIADVIVALQKNNRDIPLGLVI
FT                   SNHKQNIFKLQIEASQIEGLNNIQINKLVTMADISNVRYGTKERTAGYHGNGEPSIALA
FT                   IQRPENGSVLAAIDAAEAELEKLKAQYPQINFQVTDSSRDLVEKSNEDMFASLRDAIIM
FT                   ISVVMFLFLANWRIMLVAALSIPFVYLGTISLMWLFGQEINMVTLTGIILALGMLVDDA
FT                   VVILENIERHLHELKEDPLTAAVKGTQEVMLAVFAGTVSTMVVLAPLLFVGEYPQKIFR
FT                   PLAGTLIIAIFISYLVSITFIPLIAPKLLSKSKGKNRLEFKVQNICDFFLNPLKSFYVK
FT                   KLNLLLDKRRLRLILTVNLIVLLTVSVRVLIPLSGRDLMPPMDTGIVKVDVATDSNMDI
FT                   KSVENLLFGIEKKIYDTGNVKMLSSSIGSEPGVFTVGNGNTQNITVTAHFIDRFHRKDN
FT                   IWEIEQKIRKQLLQMPDIKYVNVYDYGATPLSTIKAPVDVMLAGSDLKNLDITGNMVLD
FT                   QMKNTGGLTGVSRSWTNDSKEFYFNIDKAKTSLYDTTPGDVVLQLSQNIQGSVASVFSI
FT                   PGESGLPVRVILARDFRKDVQDFSTFLVKTPKGFVPLNNLGSISQVYRPTMITRQGMDY
FT                   TLDVYGYRAQAAVTHIMSGVDKGLSTISLPPGVSLSQAGDIKELQDSLIRIFAAILIAL
FT                   FLLYAVLVATFKSWKAPLAIMLAIPLSLIGGAWSLILTNKHMCLPAIMGFVLLSGIIVK
FT                   NSILLIDFTEEALGQGTPLREALLKSVTLRTRAILMTAFATAVGMVPIAMEWAIGLERL
FT                   SPLAVVAIGGLIFGTFLTLLFVPVFYGMMSHKKSDRPTLTHNT"
     MIISKIMNRP HFIYTILIIL FVMGVVGYFM LPQNMFPDAE RPQISIVTLE PGASSSYIAD        60
     HVSRPIEKVL YSVSQVRKVS STSRDEVSVV TAEFEYSKGL EGAATDTANA LSRATNSLPQ       120
     DIKQPQIYKI GAYTPPVMIW ALSPQKGSNL ALADVRYLAA NSIADQLVKV RAIANVDIFG       180
     GYEKEVVVEI NKDKLSSYDL NIADVIVALQ KNNRDIPLGL VISNHKQNIF KLQIEASQIE       240
     GLNNIQINKL VTMADISNVR YGTKERTAGY HGNGEPSIAL AIQRPENGSV LAAIDAAEAE       300
     LEKLKAQYPQ INFQVTDSSR DLVEKSNEDM FASLRDAIIM ISVVMFLFLA NWRIMLVAAL       360
     SIPFVYLGTI SLMWLFGQEI NMVTLTGIIL ALGMLVDDAV VILENIERHL HELKEDPLTA       420
     AVKGTQEVML AVFAGTVSTM VVLAPLLFVG EYPQKIFRPL AGTLIIAIFI SYLVSITFIP       480
     LIAPKLLSKS KGKNRLEFKV QNICDFFLNP LKSFYVKKLN LLLDKRRLRL ILTVNLIVLL       540
     TVSVRVLIPL SGRDLMPPMD TGIVKVDVAT DSNMDIKSVE NLLFGIEKKI YDTGNVKMLS       600
     SSIGSEPGVF TVGNGNTQNI TVTAHFIDRF HRKDNIWEIE QKIRKQLLQM PDIKYVNVYD       660
     YGATPLSTIK APVDVMLAGS DLKNLDITGN MVLDQMKNTG GLTGVSRSWT NDSKEFYFNI       720
     DKAKTSLYDT TPGDVVLQLS QNIQGSVASV FSIPGESGLP VRVILARDFR KDVQDFSTFL       780
     VKTPKGFVPL NNLGSISQVY RPTMITRQGM DYTLDVYGYR AQAAVTHIMS GVDKGLSTIS       840
     LPPGVSLSQA GDIKELQDSL IRIFAAILIA LFLLYAVLVA TFKSWKAPLA IMLAIPLSLI       900
     GGAWSLILTN KHMCLPAIMG FVLLSGIIVK NSILLIDFTE EALGQGTPLR EALLKSVTLR       960
     TRAILMTAFA TAVGMVPIAM EWAIGLERLS PLAVVAIGGL IFGTFLTLLF VPVFYGMMSH      1020
     KKSDRPTLTH NT                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page