(data stored in ACNUC7421 zone)

EMBL: CP001720.PE479

CP001720.PE479       Location/Qualifiers
FT   CDS             538488..539276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61444"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61444.1"
FT                   /translation="MLKSKKIVSILLAMMIVLSIGCLSASAEESVDTTSRGYQLINGDV
FT                   YDLHGNLLLKMYDGFTADGYALDPNFTVHDPSTYVQINEDEISLMTTEILDTTSRGYQL
FT                   IDGDVYDLHGNLLIKMYDGFTADGYTLDPNFTVHDPGTYVQIDEDEISLMATEIFNGTK
FT                   YLNKNIDGNQGVQLGGDFTVSSSEPNWRLTYNSGVPTGVNFGVYNVTRGTVVEWVPKVL
FT                   PGKSLSDVFAYTSSRSNDVYRTMGSAEGSAGHASLRVVKC"
     MLKSKKIVSI LLAMMIVLSI GCLSASAEES VDTTSRGYQL INGDVYDLHG NLLLKMYDGF        60
     TADGYALDPN FTVHDPSTYV QINEDEISLM TTEILDTTSR GYQLIDGDVY DLHGNLLIKM       120
     YDGFTADGYT LDPNFTVHDP GTYVQIDEDE ISLMATEIFN GTKYLNKNID GNQGVQLGGD       180
     FTVSSSEPNW RLTYNSGVPT GVNFGVYNVT RGTVVEWVPK VLPGKSLSDV FAYTSSRSND       240
     VYRTMGSAEG SAGHASLRVV KC                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page