(data stored in ACNUC7421 zone)

EMBL: CP001720.PE48

CP001720.PE48        Location/Qualifiers
FT   CDS             complement(54120..56735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0050"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: dvu:DVUA0087 sensory box histidine kinase;
FT                   TIGRFAM: PAS sensor protein; PFAM: ATP-binding region
FT                   ATPase domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAC repeat-containing protein; PAS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61013"
FT                   /db_xref="GOA:C8VVE3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV61013.1"
FT                   /translation="MSRFKFPLIYMIVFLLLIAGIMLTDLLNYHSQQNNIMINSYYPII
FT                   ILLIVTFISLIIYLVFPEQIYKFYPLSMKNVLLKYANDILFLFDCDFNFIEINDKAIKT
FT                   YGYSHKEFLKMKFHDLIDHNKCPQFNEICKKIDSYHGYIYETVHQRKDGSTFPVEISSR
FT                   PIIAGRKKYYHSIIRDITVRKQVEDQLRQANLDLNTKIKELLHSEEKFNKAFHASPVIM
FT                   SISTLKDGRYMEINDSFVRLHGYSREEIIGRTALEIGAWNDPCDRDIVAQLLNEQGYVK
FT                   NLEVNYFTKARELHTGLLSIELINFGGEQCLIAIMHDITDLKRTEKQLQQSKQELTTLL
FT                   ENIPDIISRFDRNLRYLYVNPAVTQATGLHQNCFIGKTNRDLDMPEEQVHIWNRALEKV
FT                   FMTGKNHIIEFYYQLADKQKHFESRLIPENSPQGEVESVLVICRNITMRKEMEHRLTTY
FT                   QEQLENMVYKRTLALKKSNEQLKQEIIERLQAETALQQSERKYRALFNNTNDAILLHGI
FT                   SGNNSFESIIEVNDAVCRRLGYTREELTQLSLADIYAPESRRLLPNILNIILNRKHLTF
FT                   EVIHITKTGQKIPVEAASHLFTLNGKKVILSVIRDITERKRAEAELQEARQQAERLQTM
FT                   ASLATMTAGIAHEINQPLNSLKIMVDGLLFWHDRNGTLDENELIDGLKNISAQADRISL
FT                   IIRRMKALVRHESPPNLYPCNLNSAVEKAIVTMHAQLLASNIKLRNILQNPLPPLSGEN
FT                   FGLEEVIVILLVNAIQALNNSRQIDKEILITTRSERYIILEISDNGSGVPTDLQEKIFE
FT                   PFFTTKEVGQGMGLGLSIAHTIITSFHGQISLRTNEKGGTTFQLDFPVYNNDLIEEVGL
FT                   "
     MSRFKFPLIY MIVFLLLIAG IMLTDLLNYH SQQNNIMINS YYPIIILLIV TFISLIIYLV        60
     FPEQIYKFYP LSMKNVLLKY ANDILFLFDC DFNFIEINDK AIKTYGYSHK EFLKMKFHDL       120
     IDHNKCPQFN EICKKIDSYH GYIYETVHQR KDGSTFPVEI SSRPIIAGRK KYYHSIIRDI       180
     TVRKQVEDQL RQANLDLNTK IKELLHSEEK FNKAFHASPV IMSISTLKDG RYMEINDSFV       240
     RLHGYSREEI IGRTALEIGA WNDPCDRDIV AQLLNEQGYV KNLEVNYFTK ARELHTGLLS       300
     IELINFGGEQ CLIAIMHDIT DLKRTEKQLQ QSKQELTTLL ENIPDIISRF DRNLRYLYVN       360
     PAVTQATGLH QNCFIGKTNR DLDMPEEQVH IWNRALEKVF MTGKNHIIEF YYQLADKQKH       420
     FESRLIPENS PQGEVESVLV ICRNITMRKE MEHRLTTYQE QLENMVYKRT LALKKSNEQL       480
     KQEIIERLQA ETALQQSERK YRALFNNTND AILLHGISGN NSFESIIEVN DAVCRRLGYT       540
     REELTQLSLA DIYAPESRRL LPNILNIILN RKHLTFEVIH ITKTGQKIPV EAASHLFTLN       600
     GKKVILSVIR DITERKRAEA ELQEARQQAE RLQTMASLAT MTAGIAHEIN QPLNSLKIMV       660
     DGLLFWHDRN GTLDENELID GLKNISAQAD RISLIIRRMK ALVRHESPPN LYPCNLNSAV       720
     EKAIVTMHAQ LLASNIKLRN ILQNPLPPLS GENFGLEEVI VILLVNAIQA LNNSRQIDKE       780
     ILITTRSERY IILEISDNGS GVPTDLQEKI FEPFFTTKEV GQGMGLGLSI AHTIITSFHG       840
     QISLRTNEKG GTTFQLDFPV YNNDLIEEVG L                                      871
//

If you have problems or comments...

PBIL Back to PBIL home page