(data stored in ACNUC7421 zone)

EMBL: CP001720.PE481

CP001720.PE481       Location/Qualifiers
FT   CDS             540067..540759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bar:GBAA3129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61446"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR021617"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61446.1"
FT                   /translation="MLQLGITADLVMSGNYQALYEFLQLCLCVRAKWCNKMNIYIKHVT
FT                   VYDIGLRYLNHARGERMKLGLLDKIIKQEDIDSGIHSGESYIIWTQIVARYDTLELVDV
FT                   ILNFSNDLDFKLLVKRGIDKVIKPQLNQLIEKAKYYRLPLPPRPPESQNLSSNMETFRD
FT                   EFLYKLLMDGSQTGLDVHLKAIKICINDALRDMFMEFILQEMKLYDELIKYGKVKGWLE
FT                   NAPIYKNN"
     MLQLGITADL VMSGNYQALY EFLQLCLCVR AKWCNKMNIY IKHVTVYDIG LRYLNHARGE        60
     RMKLGLLDKI IKQEDIDSGI HSGESYIIWT QIVARYDTLE LVDVILNFSN DLDFKLLVKR       120
     GIDKVIKPQL NQLIEKAKYY RLPLPPRPPE SQNLSSNMET FRDEFLYKLL MDGSQTGLDV       180
     HLKAIKICIN DALRDMFMEF ILQEMKLYDE LIKYGKVKGW LENAPIYKNN                  230
//

If you have problems or comments...

PBIL Back to PBIL home page