(data stored in ACNUC7421 zone)

EMBL: CP001720.PE484

CP001720.PE484       Location/Qualifiers
FT   CDS             complement(543338..543769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0529"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: vok:COSY_0678
FT                   negative regulator of ferric iron uptake"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61449"
FT                   /db_xref="GOA:C8W5Z4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z4"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACV61449.1"
FT                   /translation="MLNRAYHLLKECNLRITLQRKAILEILYNCRGHHLEAENIYGLLT
FT                   VQDNNKRIGLATVYRTMELFEKIGIVSRLSMENSSARYELVMFDRLMHHHLICLKCGQL
FT                   TELDDRMAEEFKNRISEEKGFEVADKSMKIYGYCSSCKG"
     MLNRAYHLLK ECNLRITLQR KAILEILYNC RGHHLEAENI YGLLTVQDNN KRIGLATVYR        60
     TMELFEKIGI VSRLSMENSS ARYELVMFDR LMHHHLICLK CGQLTELDDR MAEEFKNRIS       120
     EEKGFEVADK SMKIYGYCSS CKG                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page