(data stored in ACNUC7421 zone)

EMBL: CP001720.PE488

CP001720.PE488       Location/Qualifiers
FT   CDS             545621..546802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0533"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="KEGG: bha:BH3300 S-adenosylmethionine synthetase;
FT                   TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61453"
FT                   /db_xref="GOA:C8W5Z8"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z8"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ACV61453.1"
FT                   /translation="MRNRVFTSESVTEGHPDKLCDQISDAVLDNILEQDKNARVACECV
FT                   ATTGMVLVTGEITSSCYVDIPSIVRQTVQNIGYDNPEYGFDYKACAVLTSIDEQSPDIA
FT                   MGVNSSYEAKKLKPDEADYIGAGDQGMMFGFACDETPELMPAPISLAHKLAQRLAGVRK
FT                   SGELNWLRPDGKTQVAVEYDDSGKILRCAAIVVSAQHNPDVSSDTLREAIIETVIKPVI
FT                   PKKYLDKDTHIYVNPTGCFVIGGPVGDSGLTGRKIIVDTYGGYASHGGGAFSGKDPTKV
FT                   DRSAAYMVRHIAKNIVAAGLAQRCQIEVAYAIGVSNPISIHIDTQGTGIFSDQRLADVV
FT                   RECFDLRPARIISYLDLRNPIYTQTAAYGHFGRPELNLPWERTNMAEILKQYK"
     MRNRVFTSES VTEGHPDKLC DQISDAVLDN ILEQDKNARV ACECVATTGM VLVTGEITSS        60
     CYVDIPSIVR QTVQNIGYDN PEYGFDYKAC AVLTSIDEQS PDIAMGVNSS YEAKKLKPDE       120
     ADYIGAGDQG MMFGFACDET PELMPAPISL AHKLAQRLAG VRKSGELNWL RPDGKTQVAV       180
     EYDDSGKILR CAAIVVSAQH NPDVSSDTLR EAIIETVIKP VIPKKYLDKD THIYVNPTGC       240
     FVIGGPVGDS GLTGRKIIVD TYGGYASHGG GAFSGKDPTK VDRSAAYMVR HIAKNIVAAG       300
     LAQRCQIEVA YAIGVSNPIS IHIDTQGTGI FSDQRLADVV RECFDLRPAR IISYLDLRNP       360
     IYTQTAAYGH FGRPELNLPW ERTNMAEILK QYK                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page