(data stored in ACNUC7421 zone)

EMBL: CP001720.PE489

CP001720.PE489       Location/Qualifiers
FT   CDS             546964..547848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0534"
FT                   /product="Methylenetetrahydrofolate reductase (NAD(P)H)"
FT                   /EC_number="1.5.1.20"
FT                   /note="PFAM: methylenetetrahydrofolate reductase; KEGG:
FT                   dol:Dole_2330 methylenetetrahydrofolate reductase
FT                   (NAD(P)H)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61454"
FT                   /db_xref="GOA:C8W5Z9"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z9"
FT                   /inference="protein motif:PRIAM:1.5.1.20"
FT                   /protein_id="ACV61454.1"
FT                   /translation="MKLSEIFKTGKPTLSFEFFPARNEKAAETFNQTIEDLVELKPDFV
FT                   SVTFGAGGSTKEGSYELVKKLKKEKELEVVAYLAAFALKKDEINAVLNSYQDLGIENIL
FT                   ALRGDPPKDADVTQVSAESFKYASELAAFIHQNYSFCLGVAGYPEGHIEAPSLKKDIEY
FT                   LKHKVDQGVDFIIAQFFYDNVCFFDFRERCQKSGINIPVLPGIMPVYSVKMMEMLAGSC
FT                   GAKIPEKLRKGISELPEGDTKALVDFGIEYATGQCEELLKEGARGLHFYTMDKSESTVG
FT                   IVKGLRNRGFLTI"
     MKLSEIFKTG KPTLSFEFFP ARNEKAAETF NQTIEDLVEL KPDFVSVTFG AGGSTKEGSY        60
     ELVKKLKKEK ELEVVAYLAA FALKKDEINA VLNSYQDLGI ENILALRGDP PKDADVTQVS       120
     AESFKYASEL AAFIHQNYSF CLGVAGYPEG HIEAPSLKKD IEYLKHKVDQ GVDFIIAQFF       180
     YDNVCFFDFR ERCQKSGINI PVLPGIMPVY SVKMMEMLAG SCGAKIPEKL RKGISELPEG       240
     DTKALVDFGI EYATGQCEEL LKEGARGLHF YTMDKSESTV GIVKGLRNRG FLTI             294
//

If you have problems or comments...

PBIL Back to PBIL home page