(data stored in ACNUC7421 zone)

EMBL: CP001720.PE490

CP001720.PE490       Location/Qualifiers
FT   CDS             548429..549193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0535"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: TipAS antibiotic-recognition domain protein;
FT                   regulatory protein MerR; Transcription regulator MerR DNA
FT                   binding; SMART: regulatory protein MerR; KEGG: bar:GBAA5200
FT                   transcriptional activator TipA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61455"
FT                   /db_xref="GOA:C8W600"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:C8W600"
FT                   /inference="protein motif:PFAM:PF07739"
FT                   /protein_id="ACV61455.1"
FT                   /translation="MEYTVQKLGRLAGISTRTLRYYDEIGILKPTRINSSGYRIYGQAE
FT                   VNRLQQILFYKELGLSLDNIKDIVTSPSFNEAEALKEHREKLLEKRKQLDLLIANVEKT
FT                   IGLTEGGRNMTDREKFEGFKQKLIDDNEKKYGKEIREKYGNEIVNKSNEKLKNMTEEEH
FT                   AEVTRLENEVTAALAEAFETGDPACDIAQKAADLHKQWLTYFWSEYNKEAHAGLAQMYV
FT                   DDERFKAYYDKKQPGVAEFLRDAIHIYTGLRK"
     MEYTVQKLGR LAGISTRTLR YYDEIGILKP TRINSSGYRI YGQAEVNRLQ QILFYKELGL        60
     SLDNIKDIVT SPSFNEAEAL KEHREKLLEK RKQLDLLIAN VEKTIGLTEG GRNMTDREKF       120
     EGFKQKLIDD NEKKYGKEIR EKYGNEIVNK SNEKLKNMTE EEHAEVTRLE NEVTAALAEA       180
     FETGDPACDI AQKAADLHKQ WLTYFWSEYN KEAHAGLAQM YVDDERFKAY YDKKQPGVAE       240
     FLRDAIHIYT GLRK                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page