(data stored in ACNUC7421 zone)

EMBL: CP001720.PE491

CP001720.PE491       Location/Qualifiers
FT   CDS             549335..549949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0536"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sfu:Sfum_3090
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61456"
FT                   /db_xref="GOA:C8W601"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C8W601"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACV61456.1"
FT                   /translation="MEKFKNLSVEKQTIIIDATLLSFGTNGYKKTSVSDIAAAAGISKA
FT                   MIFHYFGTKKTLYLYLIELCGNILMKEINEKFDANVTDFFGRIKLATDIKISVLKKHPS
FT                   ILSFLNSVYFETDDEVITEIKDFLAKGEVFRSKIVFDDMDASKFKDGIDPKLVMKMLVL
FT                   LAEGYVCQSSSKAGFDFEPLHKEFNEYLDLLKKNFYKEEYL"
     MEKFKNLSVE KQTIIIDATL LSFGTNGYKK TSVSDIAAAA GISKAMIFHY FGTKKTLYLY        60
     LIELCGNILM KEINEKFDAN VTDFFGRIKL ATDIKISVLK KHPSILSFLN SVYFETDDEV       120
     ITEIKDFLAK GEVFRSKIVF DDMDASKFKD GIDPKLVMKM LVLLAEGYVC QSSSKAGFDF       180
     EPLHKEFNEY LDLLKKNFYK EEYL                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page