(data stored in ACNUC7421 zone)

EMBL: CP001720.PE492

CP001720.PE492       Location/Qualifiers
FT   CDS             550091..550792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0537"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: mno:Mnod_0192 isoprenylcysteine carboxyl
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61457"
FT                   /db_xref="GOA:C8W602"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:C8W602"
FT                   /inference="protein motif:PFAM:PF04140"
FT                   /protein_id="ACV61457.1"
FT                   /translation="MPNKKGKFKVGQIFTSIIVSLLFIAVILFLAGDWFWIEGWVFIVF
FT                   WLTMTLSIGIYLSVNDPELLAERSKMPGSDNQKGWDKYYQSFAYVSLIAWVIIMPLDAK
FT                   RYAWSPYFPVWLKAIGGVALLPSLYFLFQSVATNTFASTMVRIQTERKQHVISTGVYGF
FT                   VRHPMYLGNLLMLVGTPLMLGSIYGLIIGLIGIFLMAVRIIGEERMLINELEGYEDYKK
FT                   KIRYRLIPFVW"
     MPNKKGKFKV GQIFTSIIVS LLFIAVILFL AGDWFWIEGW VFIVFWLTMT LSIGIYLSVN        60
     DPELLAERSK MPGSDNQKGW DKYYQSFAYV SLIAWVIIMP LDAKRYAWSP YFPVWLKAIG       120
     GVALLPSLYF LFQSVATNTF ASTMVRIQTE RKQHVISTGV YGFVRHPMYL GNLLMLVGTP       180
     LMLGSIYGLI IGLIGIFLMA VRIIGEERML INELEGYEDY KKKIRYRLIP FVW              233
//

If you have problems or comments...

PBIL Back to PBIL home page