(data stored in ACNUC7421 zone)

EMBL: CP001720.PE494

CP001720.PE494       Location/Qualifiers
FT   CDS             552086..553078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0539"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0569 nickel transport
FT                   system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61459"
FT                   /db_xref="GOA:C8W604"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W604"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61459.1"
FT                   /translation="MKIEEIDSCFTFLTAIALKSVYLYLRGMVIVLKKSVLVKFKKKKL
FT                   AAMGLVIIFILILMGIFAPVVSPHDPYAVDLTIKLLKPCAEFPLGTDQLGRCILSRLIY
FT                   GIRTSLTTAIFATVFMLAIGVPLGILAGYAGGWLDNIIMRLADIASTFPSGLCALAIVG
FT                   VWGASVVNIMIVFVLLWWAPFARIVRSIVIKLKEKEFVIAAVASGSSRTSIILKHITLN
FT                   AISPVIVLATLRIAAVIMHVAGFSFIGLGSQPPTADWGVMLSDSRQYLISDPLMLLWPG
FT                   LAIMLAVFAFNMFGEGLNDVLIPSSGDIAAVKEDDCQDGRTAYSINKKS"
     MKIEEIDSCF TFLTAIALKS VYLYLRGMVI VLKKSVLVKF KKKKLAAMGL VIIFILILMG        60
     IFAPVVSPHD PYAVDLTIKL LKPCAEFPLG TDQLGRCILS RLIYGIRTSL TTAIFATVFM       120
     LAIGVPLGIL AGYAGGWLDN IIMRLADIAS TFPSGLCALA IVGVWGASVV NIMIVFVLLW       180
     WAPFARIVRS IVIKLKEKEF VIAAVASGSS RTSIILKHIT LNAISPVIVL ATLRIAAVIM       240
     HVAGFSFIGL GSQPPTADWG VMLSDSRQYL ISDPLMLLWP GLAIMLAVFA FNMFGEGLND       300
     VLIPSSGDIA AVKEDDCQDG RTAYSINKKS                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page