(data stored in ACNUC7421 zone)

EMBL: CP001720.PE495

CP001720.PE495       Location/Qualifiers
FT   CDS             553041..553826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0540"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH0350 oligopeptide ABC transporter ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61460"
FT                   /db_xref="GOA:C8W605"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W605"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61460.1"
FT                   /translation="MAEQPILSIKNLKTYFYLVERVVKAVDGISLDVYKARITAIVGGS
FT                   GSGKSVMSLSIFNLIDDPGKIIDGEIWLNGVNIRNLKEKQLLKIRGKEISMIFQEPTSS
FT                   MNPVLKVKKHLFEVIHTQNKAIRNKEALSMFRDVLSRVGLKNTEQILESYPFELSGGMC
FT                   QRVMVAMGLLANSRVLIADEPTSSLDLTTQAAILEELVRLKNEGMAIVLITHDLGVVAQ
FT                   MADDVYVIKDGKIVESGTVYDVFESPKHEYTKSLLNSIF"
     MAEQPILSIK NLKTYFYLVE RVVKAVDGIS LDVYKARITA IVGGSGSGKS VMSLSIFNLI        60
     DDPGKIIDGE IWLNGVNIRN LKEKQLLKIR GKEISMIFQE PTSSMNPVLK VKKHLFEVIH       120
     TQNKAIRNKE ALSMFRDVLS RVGLKNTEQI LESYPFELSG GMCQRVMVAM GLLANSRVLI       180
     ADEPTSSLDL TTQAAILEEL VRLKNEGMAI VLITHDLGVV AQMADDVYVI KDGKIVESGT       240
     VYDVFESPKH EYTKSLLNSI F                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page