(data stored in ACNUC7421 zone)

EMBL: CP001720.PE498

CP001720.PE498       Location/Qualifiers
FT   CDS             556497..557240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0543"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   msu:MS0467 SmtA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61463"
FT                   /db_xref="GOA:C8W608"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W608"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV61463.1"
FT                   /translation="MDREQKLIKNWTDSSNNYSNIIKEELNSFKKKAWTDIILNNAGKN
FT                   TKMDILDVGTGPGFFTIIMSQVGNNVTAIDCTEAMINEARANAKSEGVTASFRVSDGQN
FT                   LEFDDESFDLIISRNVAWTLIDAEKAYSEWKRVLKTDGKIIMFDANWNIRLFNEAYMEK
FT                   YMEDQKEYVRLFGEEPPQYTAEMIDFRKSMPMCQRIRPQWDFNKLLELGYKKIYCETDI
FT                   GDRVYNEKERVINRSTPMFMLVVEK"
     MDREQKLIKN WTDSSNNYSN IIKEELNSFK KKAWTDIILN NAGKNTKMDI LDVGTGPGFF        60
     TIIMSQVGNN VTAIDCTEAM INEARANAKS EGVTASFRVS DGQNLEFDDE SFDLIISRNV       120
     AWTLIDAEKA YSEWKRVLKT DGKIIMFDAN WNIRLFNEAY MEKYMEDQKE YVRLFGEEPP       180
     QYTAEMIDFR KSMPMCQRIR PQWDFNKLLE LGYKKIYCET DIGDRVYNEK ERVINRSTPM       240
     FMLVVEK                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page