(data stored in ACNUC7421 zone)

EMBL: CP001720.PE499

CP001720.PE499       Location/Qualifiers
FT   CDS             557666..559429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0544"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   sat:SYN_01564 phospholipid-lipopolysaccharide ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61464"
FT                   /db_xref="GOA:C8W609"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C8W609"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61464.1"
FT                   /translation="MLYKLWKLARPSPVLLLLTGFLIILSAVSGLASPWIIRYAVDNLI
FT                   LTGRVHLLWMAAMAIIVFSLLQTGCTFAARYLAEYMGQSSLLDLRNKLYRHLNQLSFSF
FT                   YDSARTGDIMSRLTVDTNILNNFFGFAAINIVTNSLTILGIIIVLFYWNWQLGLAFLLI
FT                   TPAVVHGINTHAGKVQPAFSRLHRQLGKMTNILEESLTGIGLVKLTGSEAYELEKFEQQ
FT                   NREYLLTTMSVLKISSLWQPYVQFLTTLGIAVAMWSGGRAVIEGSITTGVLIGFITYMG
FT                   MLVRPIRQTGRMVNVVARSLAAGQRIFEVLNWEPDIKDAPDAYPLPPVKGHVCYENVSF
FT                   SYDGKNQILEEINLTVEPGQMVALVGPTGAGKTTLIHLIDRFYDPVGGSIKIDGHDLKR
FT                   VTLESLRRQLGIVLQDTFIFNTTIRENIAYGKPSATNDEVERAARLAQIHDFIISLPMG
FT                   YDTAVGTRGMTLSGGERQRIAFARVLLTNPRLLILDEATSELDAQTEAALHKAIHEVIK
FT                   NRTVIIIAHRLWTIQNADKILVLSGGRIVESGSHQELLRLDGNYSRFYDLFLQNKKLPD
FT                   NFDFGGGSQAK"
     MLYKLWKLAR PSPVLLLLTG FLIILSAVSG LASPWIIRYA VDNLILTGRV HLLWMAAMAI        60
     IVFSLLQTGC TFAARYLAEY MGQSSLLDLR NKLYRHLNQL SFSFYDSART GDIMSRLTVD       120
     TNILNNFFGF AAINIVTNSL TILGIIIVLF YWNWQLGLAF LLITPAVVHG INTHAGKVQP       180
     AFSRLHRQLG KMTNILEESL TGIGLVKLTG SEAYELEKFE QQNREYLLTT MSVLKISSLW       240
     QPYVQFLTTL GIAVAMWSGG RAVIEGSITT GVLIGFITYM GMLVRPIRQT GRMVNVVARS       300
     LAAGQRIFEV LNWEPDIKDA PDAYPLPPVK GHVCYENVSF SYDGKNQILE EINLTVEPGQ       360
     MVALVGPTGA GKTTLIHLID RFYDPVGGSI KIDGHDLKRV TLESLRRQLG IVLQDTFIFN       420
     TTIRENIAYG KPSATNDEVE RAARLAQIHD FIISLPMGYD TAVGTRGMTL SGGERQRIAF       480
     ARVLLTNPRL LILDEATSEL DAQTEAALHK AIHEVIKNRT VIIIAHRLWT IQNADKILVL       540
     SGGRIVESGS HQELLRLDGN YSRFYDLFLQ NKKLPDNFDF GGGSQAK                     587
//

If you have problems or comments...

PBIL Back to PBIL home page