(data stored in ACNUC7421 zone)

EMBL: CP001720.PE50

CP001720.PE50        Location/Qualifiers
FT   CDS             57471..59183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0052"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: bha:BH3808 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61015"
FT                   /db_xref="GOA:C8VVE6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE6"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ACV61015.1"
FT                   /translation="MGGMVNEVRVNLKRILECAFKDINNNGIFHADKLPEFVVEVPREK
FT                   GHGDFASNLAMMLAKPARMAPRRIAEIFVEHLNEEIKSDKQDGSFILLDRVEVAGPGFI
FT                   NFYLNPAWVYETLRIIETEGNDYGRVMLGSGKKVQVEFVSANPTGLLHMGNARGAALGD
FT                   CLASLLDFAGYQVTREFYVNDAGNQIENFGLTLEARYLQLLGQDCPVPEDGYHGLDIIQ
FT                   TMQGFVDKYGNKFLSAPGKVRRMVMINYALEEKLREIRNTLFDFGVRYDVWFSEKDLHE
FT                   SGAVNEAVAILKEKGHIYEKEGALWFKATEFGVEKDEVVVRSNGVPTYFAADIAYHKNK
FT                   FDRGFDRVINIWGADHHGHVSRVKGAVEAIGYDPESLDIILMQLVRLFRGTEIVRMSKR
FT                   TGQFVTLDELIEEVGRDVARYFFVMRSADSHLDFDLELAKSQSNENPVYYIQYAHARIC
FT                   SILRQLDEQGGRLPQAGAVDLALLKEEIELDLIRKMADFPEEIASAAESLAPHRLARYV
FT                   HELAGLLHSFYNSHRVIVDDAALSEARLVLVMSVKTVIKNALSLLGIAAPEKM"
     MGGMVNEVRV NLKRILECAF KDINNNGIFH ADKLPEFVVE VPREKGHGDF ASNLAMMLAK        60
     PARMAPRRIA EIFVEHLNEE IKSDKQDGSF ILLDRVEVAG PGFINFYLNP AWVYETLRII       120
     ETEGNDYGRV MLGSGKKVQV EFVSANPTGL LHMGNARGAA LGDCLASLLD FAGYQVTREF       180
     YVNDAGNQIE NFGLTLEARY LQLLGQDCPV PEDGYHGLDI IQTMQGFVDK YGNKFLSAPG       240
     KVRRMVMINY ALEEKLREIR NTLFDFGVRY DVWFSEKDLH ESGAVNEAVA ILKEKGHIYE       300
     KEGALWFKAT EFGVEKDEVV VRSNGVPTYF AADIAYHKNK FDRGFDRVIN IWGADHHGHV       360
     SRVKGAVEAI GYDPESLDII LMQLVRLFRG TEIVRMSKRT GQFVTLDELI EEVGRDVARY       420
     FFVMRSADSH LDFDLELAKS QSNENPVYYI QYAHARICSI LRQLDEQGGR LPQAGAVDLA       480
     LLKEEIELDL IRKMADFPEE IASAAESLAP HRLARYVHEL AGLLHSFYNS HRVIVDDAAL       540
     SEARLVLVMS VKTVIKNALS LLGIAAPEKM                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page