(data stored in ACNUC7421 zone)

EMBL: CP001720.PE502

CP001720.PE502       Location/Qualifiers
FT   CDS             complement(563699..564778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0547"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   dal:Dalk_3523 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61467"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C8W612"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACV61467.1"
FT                   /translation="MTYCRKISRIILLFLLCTVLFHSNSQALAGEPEKKIVRDVTGKTI
FT                   LVPEIPKRIISLQDDASELIYALGAADQLIGVNENCTSQFFLQDREKIPAITVSNISKI
FT                   TALKADLVIADPAAEKDSLQLLKKKGIPVFLFDCNKTEELSKNIKLLGIALGKETAAEE
FT                   YTDINDKYISLIKTRTKNLSANERPRVYLEADNDYITLNLNDDKSKLVQLAGGLNIASE
FT                   KRFKTMSFVDNKWIIAKNPSIIIKYVDNVSNSGFSETMLKNKKEGMLARTNWKNIEAVK
FT                   NDKIYLLTCDICRGPRYAIGLAYMAKWLHPELFSDLDPDAFYQEINQNFYGQQLNLASV
FT                   YPYNEIEVQEQSQIPANVK"
     MTYCRKISRI ILLFLLCTVL FHSNSQALAG EPEKKIVRDV TGKTILVPEI PKRIISLQDD        60
     ASELIYALGA ADQLIGVNEN CTSQFFLQDR EKIPAITVSN ISKITALKAD LVIADPAAEK       120
     DSLQLLKKKG IPVFLFDCNK TEELSKNIKL LGIALGKETA AEEYTDINDK YISLIKTRTK       180
     NLSANERPRV YLEADNDYIT LNLNDDKSKL VQLAGGLNIA SEKRFKTMSF VDNKWIIAKN       240
     PSIIIKYVDN VSNSGFSETM LKNKKEGMLA RTNWKNIEAV KNDKIYLLTC DICRGPRYAI       300
     GLAYMAKWLH PELFSDLDPD AFYQEINQNF YGQQLNLASV YPYNEIEVQE QSQIPANVK        359
//

If you have problems or comments...

PBIL Back to PBIL home page