(data stored in ACNUC7421 zone)

EMBL: CP001720.PE505

CP001720.PE505       Location/Qualifiers
FT   CDS             566580..566939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0550"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: abo:ABO_1703
FT                   ArsR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61470"
FT                   /db_xref="GOA:C8W615"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W615"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ACV61470.1"
FT                   /translation="MEISMENLAIIFKALSNKNRLIIFHELLHREGLHLGLGSESCCGQ
FT                   HNKGNCCIGELGKKVQLAPSTISHHIKELKNAGLIDISREGNFLYCSVNFANWSKVLSF
FT                   FSSCQPGQGDSHQHK"
     MEISMENLAI IFKALSNKNR LIIFHELLHR EGLHLGLGSE SCCGQHNKGN CCIGELGKKV        60
     QLAPSTISHH IKELKNAGLI DISREGNFLY CSVNFANWSK VLSFFSSCQP GQGDSHQHK        119
//

If you have problems or comments...

PBIL Back to PBIL home page