(data stored in ACNUC7421 zone)

EMBL: CP001720.PE507

CP001720.PE507       Location/Qualifiers
FT   CDS             complement(567493..568227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0552"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ppd:Ppro_1264
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61472"
FT                   /db_xref="GOA:C8W617"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C8W617"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACV61472.1"
FT                   /translation="MSGLRAVLWREYLFFKRRWWTITTGSMVAPLLYMVAFGWGLGKTV
FT                   NLGGVAYIDFIVPGIVALSTMNVSFNAVATPLSIARLYDKTLEEYLVAPITVYSFAAGK
FT                   ILAGALRGLYAAAILLVISWFFRADLIFNLWFVLLLCLNCLVFSSLGFLVALKIKSHPD
FT                   MTRFNNFVITPMTFVCGTFFSVDRVPFPFSQIIKLLPLTPASHGLRSVALGTDLPWTEP
FT                   AIQIFYLALFVIWGIKTCLKVE"
     MSGLRAVLWR EYLFFKRRWW TITTGSMVAP LLYMVAFGWG LGKTVNLGGV AYIDFIVPGI        60
     VALSTMNVSF NAVATPLSIA RLYDKTLEEY LVAPITVYSF AAGKILAGAL RGLYAAAILL       120
     VISWFFRADL IFNLWFVLLL CLNCLVFSSL GFLVALKIKS HPDMTRFNNF VITPMTFVCG       180
     TFFSVDRVPF PFSQIIKLLP LTPASHGLRS VALGTDLPWT EPAIQIFYLA LFVIWGIKTC       240
     LKVE                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page