(data stored in ACNUC7421 zone)

EMBL: CP001720.PE508

CP001720.PE508       Location/Qualifiers
FT   CDS             complement(568227..569066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0553"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sfu:Sfum_1827 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61473"
FT                   /db_xref="GOA:C8W618"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W618"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61473.1"
FT                   /translation="MIKLENVSKNYKQTVSVNKLNLHIKTGEFFGLLGPNGAGKTTTVR
FT                   MLTALTMPTEGSIVVNGCRAHRNDTRFKAEVGLVPQHINLEPELTVVENLRLHAMLYSI
FT                   PQEQARIRIEELLAFTGLEEKAGTLVNTLSGGTKRKVLIARALMHKPRILLLDEPTVGL
FT                   DVFIRRKVWDLIKSLNSRGITILLTTHYLEEAETLCNRIGLLKKGELIMDGSPEELKKV
FT                   VGPVVVEEFRDERTILHFFASRQEALEHAGALRDEFTIRQTKLEDVFVKLTEERVST"
     MIKLENVSKN YKQTVSVNKL NLHIKTGEFF GLLGPNGAGK TTTVRMLTAL TMPTEGSIVV        60
     NGCRAHRNDT RFKAEVGLVP QHINLEPELT VVENLRLHAM LYSIPQEQAR IRIEELLAFT       120
     GLEEKAGTLV NTLSGGTKRK VLIARALMHK PRILLLDEPT VGLDVFIRRK VWDLIKSLNS       180
     RGITILLTTH YLEEAETLCN RIGLLKKGEL IMDGSPEELK KVVGPVVVEE FRDERTILHF       240
     FASRQEALEH AGALRDEFTI RQTKLEDVFV KLTEERVST                              279
//

If you have problems or comments...

PBIL Back to PBIL home page