(data stored in ACNUC7421 zone)

EMBL: CP001720.PE509

CP001720.PE509       Location/Qualifiers
FT   CDS             complement(569059..569781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0554"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /EC_number="2.1.1.151"
FT                   /note="KEGG: sfu:Sfum_2135 precorrin-2 C20-
FT                   methyltransferase; TIGRFAM: precorrin-2
FT                   C20-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61474"
FT                   /db_xref="GOA:C8W619"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C8W619"
FT                   /inference="protein motif:TFAM:TIGR01467"
FT                   /protein_id="ACV61474.1"
FT                   /translation="MQGTFYGVGVGPGEPELITLKAVKILREADVVIAPRTEKKKGSTA
FT                   LFIARSFIRQDAHILELVFPMVFDPDVLAAAWEHNKNIIISFLNEGKNVAFLTLGDPML
FT                   YSTYFYIFKLLNGKGLKIETIPGVPSFCAAASRLGIPLAEDNDVLSIVPATLADEKIEK
FT                   VLSCSDSIVMMRVYKNYDQIVGHLNRHGLSEKAVMISRCGFADEEITCNLNGSKDKKPN
FT                   YLSTILARKHSAMDCNYD"
     MQGTFYGVGV GPGEPELITL KAVKILREAD VVIAPRTEKK KGSTALFIAR SFIRQDAHIL        60
     ELVFPMVFDP DVLAAAWEHN KNIIISFLNE GKNVAFLTLG DPMLYSTYFY IFKLLNGKGL       120
     KIETIPGVPS FCAAASRLGI PLAEDNDVLS IVPATLADEK IEKVLSCSDS IVMMRVYKNY       180
     DQIVGHLNRH GLSEKAVMIS RCGFADEEIT CNLNGSKDKK PNYLSTILAR KHSAMDCNYD       240
//

If you have problems or comments...

PBIL Back to PBIL home page