(data stored in ACNUC7421 zone)

EMBL: CP001720.PE511

CP001720.PE511       Location/Qualifiers
FT   CDS             complement(570779..571573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0556"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dal:Dalk_0442 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61476"
FT                   /db_xref="GOA:C8W621"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W621"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61476.1"
FT                   /translation="MKQGVLIKTDSLTLCYGKYTALQEVSLDIREGGFYGILGPNGSGK
FT                   TTLINIMCGVLKPSSGHITWNGKELSSCSRRHIARSFAVVPQNCSINFPFSVLEVVMMG
FT                   RKPHLGRMGRLSHKDLEIVYNCMEHCSVLEHAQKAITSLSGGERQRVLLARALAQTPQV
FT                   LFLDEATSNLDISHKLELLKLIKKLNTEKAVTVIAVLHDLNFAGMFCEYLVYMDKGRVI
FT                   CEGPANLVFNEEMINKVFHVQVEIKKHAVTGKYNLTLLPDLE"
     MKQGVLIKTD SLTLCYGKYT ALQEVSLDIR EGGFYGILGP NGSGKTTLIN IMCGVLKPSS        60
     GHITWNGKEL SSCSRRHIAR SFAVVPQNCS INFPFSVLEV VMMGRKPHLG RMGRLSHKDL       120
     EIVYNCMEHC SVLEHAQKAI TSLSGGERQR VLLARALAQT PQVLFLDEAT SNLDISHKLE       180
     LLKLIKKLNT EKAVTVIAVL HDLNFAGMFC EYLVYMDKGR VICEGPANLV FNEEMINKVF       240
     HVQVEIKKHA VTGKYNLTLL PDLE                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page