(data stored in ACNUC7421 zone)

EMBL: CP001720.PE514

CP001720.PE514       Location/Qualifiers
FT   CDS             574935..578441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0559"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61479"
FT                   /db_xref="GOA:C8W624"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:C8W624"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACV61479.1"
FT                   /translation="MRRKNTKLQFITLSVMIFFILNIIQFSGLTSQSANGQEAVYTSAE
FT                   MAAKAVDFINDKYKAGEKIDGYTAYVLAMAGQDLSSEKWSINGTSLRSEIENLADLMGN
FT                   NVNLINYVCLTQNNDGSFGPYANEYGTKVPLQALSTVKEDITVGSDVYNQVQSAIDNAV
FT                   NFFKTKYQNGGMTYDVNGWSFDYRCVEALAKSGEDLSVGGWVYNGVSLKDSIMLSANST
FT                   ARSIKKDSSVQDAVYLSKELTALYAVDKASTDIDVLAGAITAKQNGDGSFGTNMFDHIM
FT                   VLNALGKAGAISNIDQTKAFNFIDNLKEIHKNSWGQDAGVAWGSQYTSGFEESDTTAQV
FT                   ITALSYFSEAKNEGSDVYKTIQGGLTYLNDVQDADTAAIVRIEGDSTFSSAETLLALKS
FT                   LGYTFDQYTGTASKWVKNSRTKTITQCIKAVNKWGDAGRLDRLIRLLADRQKAEDPGKG
FT                   SFENSVYSDMWAYLALGEAGKLDGLNTGDAKTYILSKQDTSGSWGEIFDQYYPDFLSTA
FT                   QAIRSLSYLPEAGEADVQAAINKGLNYLKTLQRDDGSVSAKDDDPAVDNSELIITLNRL
FT                   NIDPQGAEWTKTVDGKKFTPVSYLMNNTMNADGSFGASKNVFGATEALYAYLIQDGTGN
FT                   PGGDGPGGGSSENRCSVNIAIVGKDDEIIYRPGSVILDKTSKWGITAMGALHATGLSYV
FT                   GDSSFVKSIDGLANSGMNGWMYSVNGVVPMTTASDKVVKEGDRVIWWYSTDMNSSGPSW
FT                   DSLLKGSAGAGGNQSAAASSTSLIEQNKELPDALQVSEKALAALEQIALLLNPQDIEKE
FT                   NTLDASVQDDEINNVIVVGSRQPLNLALLKTLKKELDQNEVQLTQKVEADSGAVLLDAK
FT                   EELALVIPAKSLNKDMEINVKEAAAGNQQETAAPSGFRQVSAIYDFGPKDTVFTMPATL
FT                   TFKLVMPPLVKPDRLVLAYYDKVAGKWVSVPAVVDLDKGLVLTKLRHLGQYAVFARESL
FT                   KTFADVNETSSSWAKDYIENLAGAGIVDGIDATHFEPSRKVTRAELTSLLVKALGISTD
FT                   QSSAISLKDVQADDWYAGAVGAAQAAGLITGYEDGTFRPGNTVSREELAVILVRAMKLE
FT                   SDQEKMWFADIDKINSWARDSVFTASSKGLIKGFPDGTFRPDVAAGRDECAVIIFRMLN
FT                   EY"
     MRRKNTKLQF ITLSVMIFFI LNIIQFSGLT SQSANGQEAV YTSAEMAAKA VDFINDKYKA        60
     GEKIDGYTAY VLAMAGQDLS SEKWSINGTS LRSEIENLAD LMGNNVNLIN YVCLTQNNDG       120
     SFGPYANEYG TKVPLQALST VKEDITVGSD VYNQVQSAID NAVNFFKTKY QNGGMTYDVN       180
     GWSFDYRCVE ALAKSGEDLS VGGWVYNGVS LKDSIMLSAN STARSIKKDS SVQDAVYLSK       240
     ELTALYAVDK ASTDIDVLAG AITAKQNGDG SFGTNMFDHI MVLNALGKAG AISNIDQTKA       300
     FNFIDNLKEI HKNSWGQDAG VAWGSQYTSG FEESDTTAQV ITALSYFSEA KNEGSDVYKT       360
     IQGGLTYLND VQDADTAAIV RIEGDSTFSS AETLLALKSL GYTFDQYTGT ASKWVKNSRT       420
     KTITQCIKAV NKWGDAGRLD RLIRLLADRQ KAEDPGKGSF ENSVYSDMWA YLALGEAGKL       480
     DGLNTGDAKT YILSKQDTSG SWGEIFDQYY PDFLSTAQAI RSLSYLPEAG EADVQAAINK       540
     GLNYLKTLQR DDGSVSAKDD DPAVDNSELI ITLNRLNIDP QGAEWTKTVD GKKFTPVSYL       600
     MNNTMNADGS FGASKNVFGA TEALYAYLIQ DGTGNPGGDG PGGGSSENRC SVNIAIVGKD       660
     DEIIYRPGSV ILDKTSKWGI TAMGALHATG LSYVGDSSFV KSIDGLANSG MNGWMYSVNG       720
     VVPMTTASDK VVKEGDRVIW WYSTDMNSSG PSWDSLLKGS AGAGGNQSAA ASSTSLIEQN       780
     KELPDALQVS EKALAALEQI ALLLNPQDIE KENTLDASVQ DDEINNVIVV GSRQPLNLAL       840
     LKTLKKELDQ NEVQLTQKVE ADSGAVLLDA KEELALVIPA KSLNKDMEIN VKEAAAGNQQ       900
     ETAAPSGFRQ VSAIYDFGPK DTVFTMPATL TFKLVMPPLV KPDRLVLAYY DKVAGKWVSV       960
     PAVVDLDKGL VLTKLRHLGQ YAVFARESLK TFADVNETSS SWAKDYIENL AGAGIVDGID      1020
     ATHFEPSRKV TRAELTSLLV KALGISTDQS SAISLKDVQA DDWYAGAVGA AQAAGLITGY      1080
     EDGTFRPGNT VSREELAVIL VRAMKLESDQ EKMWFADIDK INSWARDSVF TASSKGLIKG      1140
     FPDGTFRPDV AAGRDECAVI IFRMLNEY                                         1168
//

If you have problems or comments...

PBIL Back to PBIL home page