(data stored in ACNUC7421 zone)

EMBL: CP001720.PE515

CP001720.PE515       Location/Qualifiers
FT   CDS             578538..579269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bar:GBAA3366 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61480"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:C8W625"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61480.1"
FT                   /translation="MGILKKKIIYITLTLVILAAILGPSIYANKFSRNQIAAQFKNNTT
FT                   TQTGESKSLPASDASKAGEQKTEAKQEAELKTGDAMPFQESEATDKDIKTKPVDKNNNS
FT                   GLSENKDSAGQLNKNAAAPDSSQEISRTVGMAVVGKEGELLYAPGSVTVTSKNIWDTTA
FT                   LGALDATSLPYKVSSGFSGFVEEIAGCRNKGQSGWMYMVNGEVPGVSASQKQVKTGDKV
FT                   IWWYSKSMDAPMPDWDALLKK"
     MGILKKKIIY ITLTLVILAA ILGPSIYANK FSRNQIAAQF KNNTTTQTGE SKSLPASDAS        60
     KAGEQKTEAK QEAELKTGDA MPFQESEATD KDIKTKPVDK NNNSGLSENK DSAGQLNKNA       120
     AAPDSSQEIS RTVGMAVVGK EGELLYAPGS VTVTSKNIWD TTALGALDAT SLPYKVSSGF       180
     SGFVEEIAGC RNKGQSGWMY MVNGEVPGVS ASQKQVKTGD KVIWWYSKSM DAPMPDWDAL       240
     LKK                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page