(data stored in ACNUC7421 zone)

EMBL: CP001720.PE517

CP001720.PE517       Location/Qualifiers
FT   CDS             580711..581640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0562"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: bar:GBAA3365
FT                   ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61482"
FT                   /db_xref="GOA:C8W627"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C8W627"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ACV61482.1"
FT                   /translation="MREKLFYQEKGLFIQSLHPFTSVVYLGTLLFLSLAFNNPLYLLGI
FT                   LIMIVLAIWAADGWKTWETYMIISLPMILLIIVINPLINSAGKTVLWYGPHIPFWGRLN
FT                   ISLEAICYGAAMSVRLLDIISLFCLYNIIVHPDKVLNLFSRFAGKSTLVISLSTRLFPS
FT                   MFRELENVKDVQRLRGVDFRQGTIKERIKKHFSLINILLLSSLENSLGIAESMQARAFG
FT                   SGPRSVYSAHMLRPRDILCLSGSSLALGISIWGLLRGFGMYNFYPQLDFLINDPVTVVV
FT                   LAAVMLSLSVPVLLSWGWQYCRFMKSKI"
     MREKLFYQEK GLFIQSLHPF TSVVYLGTLL FLSLAFNNPL YLLGILIMIV LAIWAADGWK        60
     TWETYMIISL PMILLIIVIN PLINSAGKTV LWYGPHIPFW GRLNISLEAI CYGAAMSVRL       120
     LDIISLFCLY NIIVHPDKVL NLFSRFAGKS TLVISLSTRL FPSMFRELEN VKDVQRLRGV       180
     DFRQGTIKER IKKHFSLINI LLLSSLENSL GIAESMQARA FGSGPRSVYS AHMLRPRDIL       240
     CLSGSSLALG ISIWGLLRGF GMYNFYPQLD FLINDPVTVV VLAAVMLSLS VPVLLSWGWQ       300
     YCRFMKSKI                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page