(data stored in ACNUC7421 zone)

EMBL: CP001720.PE52

CP001720.PE52        Location/Qualifiers
FT   CDS             59444..61054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0054"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="KEGG: bsu:BSU37150 CTP synthetase; TIGRFAM: CTP
FT                   synthase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61017"
FT                   /db_xref="GOA:C8VVE8"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE8"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ACV61017.1"
FT                   /translation="MAKFIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKLDPYIN
FT                   IDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLSRSSNVTTGGIYWSVITKERR
FT                   GDYLGGTVQVIPHITNEIKERVLRVAEEKNPDVVITEIGGTVGDIESLPFMEAIRQLKG
FT                   DLGRGNVMYIHVTLVPYLKVANELKTKPTQHSVKELRGIGIQPDVIVCRTEEPISKDME
FT                   EKLALFCDIDKEAVIQAVDARSIYEVPLMLEREGLADIAVERLRLECSPPDLTEWQDMV
FT                   LRMSHLRQETNIALVGKYVSLPDAYLSVAEALRHAGLYHGSAVNIKWINAEDLERVPAE
FT                   EYLRDADGILVPGGFGDRGIEGKIFAIKYARENLIPMLGICLGMQLAVVEYARNMMGWR
FT                   LANSTEFNPQTPYPVIDLLPTQKNIEDMGGTMRLGRYPCKLLPNTKAYLSYKQEIIYER
FT                   HRHRYELNNTFRAGLAEKGLIMSGTLPNGQLVEIVELPEHPWFVATQFHPEFKSRPNRP
FT                   HPLFRDFIGAALERGKNKI"
     MAKFIFVTGG VVSSLGKGIT AASLGRLLKN RGLNVTIQKL DPYINIDPGT MSPYQHGEVF        60
     VTDDGAETDL DLGHYERFID INLSRSSNVT TGGIYWSVIT KERRGDYLGG TVQVIPHITN       120
     EIKERVLRVA EEKNPDVVIT EIGGTVGDIE SLPFMEAIRQ LKGDLGRGNV MYIHVTLVPY       180
     LKVANELKTK PTQHSVKELR GIGIQPDVIV CRTEEPISKD MEEKLALFCD IDKEAVIQAV       240
     DARSIYEVPL MLEREGLADI AVERLRLECS PPDLTEWQDM VLRMSHLRQE TNIALVGKYV       300
     SLPDAYLSVA EALRHAGLYH GSAVNIKWIN AEDLERVPAE EYLRDADGIL VPGGFGDRGI       360
     EGKIFAIKYA RENLIPMLGI CLGMQLAVVE YARNMMGWRL ANSTEFNPQT PYPVIDLLPT       420
     QKNIEDMGGT MRLGRYPCKL LPNTKAYLSY KQEIIYERHR HRYELNNTFR AGLAEKGLIM       480
     SGTLPNGQLV EIVELPEHPW FVATQFHPEF KSRPNRPHPL FRDFIGAALE RGKNKI           536
//

If you have problems or comments...

PBIL Back to PBIL home page