(data stored in ACNUC7421 zone)

EMBL: CP001720.PE524

CP001720.PE524       Location/Qualifiers
FT   CDS             588602..589804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0569"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="KEGG: sat:SYN_02155 acetylornithine
FT                   aminotransferase; TIGRFAM: acetylornithine and
FT                   succinylornithine aminotransferase; PFAM: aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61489"
FT                   /db_xref="GOA:C8W634"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W634"
FT                   /inference="protein motif:TFAM:TIGR00707"
FT                   /protein_id="ACV61489.1"
FT                   /translation="MNNQEIIEVGGKYVMNTYGRLPMALVKGEGVKVWDADGNEYLDFI
FT                   AGLAVNSLGHCHPAVTEAIARQACALMHCSNIYWIEPQVKLARLLAENSDLDKVFFCNS
FT                   GAEANEGAIKLARKYAKQHLGSGKYEIITALNSFHGRTLAAITATGQAKYQQGLEPLPA
FT                   GFKYVPFGNIEALKEAVGPHTCAVMLEPVQGEGGVNLAAQEYWNQVQELCSEEGLLLIL
FT                   DEVQCGLGRTGKFLAYMHYGLKPDIVTLAKALGGGFPIGAMMAVEKVASAFQPGDHAAT
FT                   FGGNPLASAAALAAMNTMLNEGIILNAEKVGNYFKHKLTELAAKYPVISEVRGLGLMLG
FT                   AQLTVPGADIVSYCQQKGLLINCANGNVLRFIPPLIITESDVDKVVNLLDEALGKIEKR
FT                   V"
     MNNQEIIEVG GKYVMNTYGR LPMALVKGEG VKVWDADGNE YLDFIAGLAV NSLGHCHPAV        60
     TEAIARQACA LMHCSNIYWI EPQVKLARLL AENSDLDKVF FCNSGAEANE GAIKLARKYA       120
     KQHLGSGKYE IITALNSFHG RTLAAITATG QAKYQQGLEP LPAGFKYVPF GNIEALKEAV       180
     GPHTCAVMLE PVQGEGGVNL AAQEYWNQVQ ELCSEEGLLL ILDEVQCGLG RTGKFLAYMH       240
     YGLKPDIVTL AKALGGGFPI GAMMAVEKVA SAFQPGDHAA TFGGNPLASA AALAAMNTML       300
     NEGIILNAEK VGNYFKHKLT ELAAKYPVIS EVRGLGLMLG AQLTVPGADI VSYCQQKGLL       360
     INCANGNVLR FIPPLIITES DVDKVVNLLD EALGKIEKRV                             400
//

If you have problems or comments...

PBIL Back to PBIL home page