(data stored in ACNUC7421 zone)

EMBL: CP001720.PE525

CP001720.PE525       Location/Qualifiers
FT   CDS             589832..590794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0570"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: bsu:BSU11250 ornithine carbamoyltransferase;
FT                   TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61490"
FT                   /db_xref="GOA:C8W635"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C8W635"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ACV61490.1"
FT                   /translation="MSSLLQLPISKDFKGRDFLLLLDFSAEEIKHLINVAVELKAIQKK
FT                   GEPHPYLQGKTLAMIFQKSSTRTRVSFEVAMYQLGGYPLFLSSNDLQMGRGETIADTAR
FT                   TLSRYVDGIMIRTYAQSDVEELAEYADIPVINGLTDLVHPTQVIADLQTVLEHKGKLAG
FT                   LKMAFLGDGNNVAHSLMAGCAKVGMNITLANPAGYKPLPEMVEKAKQVAETTGSIIEII
FT                   EDPVAAVKDADVIYTDVWASMGQEKEQEERAKMMAPYQVNAELVRHAKPDYIFLHCLPA
FT                   KREQEVTSEILDSNHSAAFDEAENRLHAHKAILALLMQK"
     MSSLLQLPIS KDFKGRDFLL LLDFSAEEIK HLINVAVELK AIQKKGEPHP YLQGKTLAMI        60
     FQKSSTRTRV SFEVAMYQLG GYPLFLSSND LQMGRGETIA DTARTLSRYV DGIMIRTYAQ       120
     SDVEELAEYA DIPVINGLTD LVHPTQVIAD LQTVLEHKGK LAGLKMAFLG DGNNVAHSLM       180
     AGCAKVGMNI TLANPAGYKP LPEMVEKAKQ VAETTGSIIE IIEDPVAAVK DADVIYTDVW       240
     ASMGQEKEQE ERAKMMAPYQ VNAELVRHAK PDYIFLHCLP AKREQEVTSE ILDSNHSAAF       300
     DEAENRLHAH KAILALLMQK                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page