(data stored in ACNUC7421 zone)

EMBL: CP001720.PE526

CP001720.PE526       Location/Qualifiers
FT   CDS             590853..592058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0571"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: Os12g0235800; hypothetical protein ; K01940
FT                   argininosuccinate synthase; TIGRFAM: argininosuccinate
FT                   synthase; PFAM: argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61491"
FT                   /db_xref="GOA:C8W636"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:C8W636"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ACV61491.1"
FT                   /translation="MAKVVLAYSGGLDTSIIIPWLKENYGYEVIAMAADLGQGEELEPL
FT                   HEKAVKSGASKLYIEDVRKEFVEEYIFPTLRAGAIYEGKYLLGTSMARPLIAKKLVEIA
FT                   VKEGAEAVAHGATGKGNDQVRFELGVKALKPELKIIAPWREWDIRSRDDAIDYAQARGI
FT                   PVPVTKERPYSMDRNLWHLSHEGGDLESPWNEPPQDLYLLTVAPEKAPDQPAYVELEFE
FT                   QGRPVKLNGTACDPVTLIEKLNELGGQNGIGITDMVENRLVGMKSRGVYETPGGTILYN
FT                   AHREMELLTLDRMTLHYKELVAARYAELVYEGVWFAPLREALDAFVDATQRTVTGTVRM
FT                   KLYKGNCTPAGAKSPYSLYSEELATFGRDEVYSQKDAAGFINLFGLPLKVRAMMEQKTG
FT                   LR"
     MAKVVLAYSG GLDTSIIIPW LKENYGYEVI AMAADLGQGE ELEPLHEKAV KSGASKLYIE        60
     DVRKEFVEEY IFPTLRAGAI YEGKYLLGTS MARPLIAKKL VEIAVKEGAE AVAHGATGKG       120
     NDQVRFELGV KALKPELKII APWREWDIRS RDDAIDYAQA RGIPVPVTKE RPYSMDRNLW       180
     HLSHEGGDLE SPWNEPPQDL YLLTVAPEKA PDQPAYVELE FEQGRPVKLN GTACDPVTLI       240
     EKLNELGGQN GIGITDMVEN RLVGMKSRGV YETPGGTILY NAHREMELLT LDRMTLHYKE       300
     LVAARYAELV YEGVWFAPLR EALDAFVDAT QRTVTGTVRM KLYKGNCTPA GAKSPYSLYS       360
     EELATFGRDE VYSQKDAAGF INLFGLPLKV RAMMEQKTGL R                           401
//

If you have problems or comments...

PBIL Back to PBIL home page