(data stored in ACNUC7421 zone)

EMBL: CP001720.PE53

CP001720.PE53        Location/Qualifiers
FT   CDS             61350..61751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0055"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: bsu:BSU37130 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61018"
FT                   /db_xref="GOA:C8VVE9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV61018.1"
FT                   /translation="MGDCDLLIVDDQPGIRRLLYEVLSEDGYRVEAVAGGREAIDKAVL
FT                   LRPRLILLDMKMPGMNGLETLIELNKVYKDATAVILMTAYGELEIVMQAQKLGVNHYIN
FT                   KPFDLEDIRALIKSLIPDGAEIDRSRDIV"
     MGDCDLLIVD DQPGIRRLLY EVLSEDGYRV EAVAGGREAI DKAVLLRPRL ILLDMKMPGM        60
     NGLETLIELN KVYKDATAVI LMTAYGELEI VMQAQKLGVN HYINKPFDLE DIRALIKSLI       120
     PDGAEIDRSR DIV                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page